Інсуліноподібний фактор росту 1

Інсуліноподібний фактор росту 1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

1B9G, 1GZR, 1GZY, 1GZZ, 1H02, 1H59, 1IMX, 1PMX, 1TGR, 1WQJ, 2DSR, 2GF1, 3GF1, 3LRI, 1BQT, 4XSS

Ідентифікатори
Символи IGF1, IGF-I, IGF1A, IGFI, MGF, insulin like growth factor 1, IGF
Зовнішні ІД OMIM: 147440 HomoloGene: 515 GeneCards: IGF1
Пов'язані генетичні захворювання
growth delay due to insulin-like growth factor type 1 deficiency[1]
Онтологія гена
Молекулярна функція

• hormone activity
• insulin receptor binding
• growth factor activity
• integrin binding
• GO:0001948, GO:0016582 protein binding
• insulin-like growth factor receptor binding

Клітинна компонента

• extracellular region
• exocytic vesicle
• insulin-like growth factor binding protein complex
• platelet alpha granule lumen
• insulin-like growth factor ternary complex
• alphav-beta3 integrin-IGF-1-IGF1R complex
• клітинна мембрана
• міжклітинний простір

Біологічний процес

• positive regulation of transcription regulatory region DNA binding
• skeletal system development
• positive regulation of glucose import
• muscle organ development
• positive regulation of Ras protein signal transduction
• response to heat
• positive regulation of cardiac muscle hypertrophy
• positive regulation of smooth muscle cell migration
• реплікація ДНК
• positive regulation of insulin-like growth factor receptor signaling pathway
• phosphatidylinositol 3-kinase signaling
• positive regulation of DNA binding
• Ras protein signal transduction
• проліферація
• positive regulation of mitotic nuclear division
• positive regulation of trophectodermal cell proliferation
• positive regulation of glycogen biosynthetic process
• positive regulation of fibroblast proliferation
• ERK1 and ERK2 cascade
• negative regulation of extrinsic apoptotic signaling pathway
• cell activation
• negative regulation of oocyte development
• GO:0060469, GO:0009371 positive regulation of transcription, DNA-templated
• bone mineralization involved in bone maturation
• positive regulation of peptidyl-tyrosine phosphorylation
• positive regulation of MAPK cascade
• proteoglycan biosynthetic process
• positive regulation of activated T cell proliferation
• positive regulation of epithelial cell proliferation
• negative regulation of release of cytochrome c from mitochondria
• protein stabilization
• myotube cell development
• positive regulation of DNA replication
• myoblast proliferation
• skeletal muscle satellite cell maintenance involved in skeletal muscle regeneration
• positive regulation of protein secretion
• positive regulation of glycoprotein biosynthetic process
• регуляція експресії генів
• phosphatidylinositol-mediated signaling
• positive regulation of smooth muscle cell proliferation
• muscle hypertrophy
• protein kinase B signaling
• regulation of multicellular organism growth
• positive regulation of cell migration
• platelet degranulation
• positive regulation of calcineurin-NFAT signaling cascade
• positive regulation of phosphatidylinositol 3-kinase signaling
• myoblast differentiation
• glycolate metabolic process
• positive regulation of glycolytic process
• negative regulation of smooth muscle cell apoptotic process
• GO:0072468 сигнальна трансдукція
• GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
• positive regulation of cell growth involved in cardiac muscle cell development
• positive regulation of cell population proliferation
• positive regulation of osteoblast differentiation
• activation of protein kinase B activity
• insulin-like growth factor receptor signaling pathway
• negative regulation of apoptotic process
• positive regulation of tyrosine phosphorylation of STAT protein
• regulation of signaling receptor activity
• GO:1901313 positive regulation of gene expression
• negative regulation of gene expression
• cellular response to amyloid-beta
• positive regulation of vascular associated smooth muscle cell proliferation
• negative regulation of vascular associated smooth muscle cell apoptotic process
• negative regulation of interleukin-1 beta production
• negative regulation of tumor necrosis factor production
• negative regulation of neuroinflammatory response
• negative regulation of amyloid-beta formation

Джерела:Amigo / QuickGO
Шаблон експресії




Більше даних
Ортологи
Види Людина Миша
Entrez
3479
24482
Ensembl
ENSG00000017427
ENSRNOG00000004517
UniProt
P05019
P08025
RefSeq (мРНК)
NM_000618
NM_001111283
NM_001111284
NM_001111285
NM_001082477
NM_001082478
NM_001082479
NM_178866
RefSeq (білок)
NP_000609
NP_001104753
NP_001104754
NP_001104755
NP_001075946
NP_001075947
NP_001075948
NP_849197
Локус (UCSC) Хр. 12: 102.4 – 102.48 Mb н/д
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Інсуліноподібний фактор росту 1 (ІФР-1, англ. Insulin like growth factor, 1 IGF-1) або соматомедін C – білок, який кодується геном IGF1, розташованим у людини на довгому плечі 12-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 195 амінокислот, а молекулярна маса — 21 841[5]. Поліпептидний гормон та фактор росту, подібний за структурою до інсуліну.[6] Він здійснює ендокринну, автокринну і паракринну регуляцію процесів росту і розвитку і грає важливу роль в рості дитини та має анаболічний ефект в дорослих.

Цей ген є висококонсервативним у різних видів ссавців, зокрема й у ділянці промотору та інших регуляторних послідовностей, що свідчить про наявність шляхів регуляції із залученням ІФР-1 у предків сучасних ссавців[7].

В ембріонів бика ІФР-1 синтезується, починаючи з ранніх етапів дроблення, на стадії бластоцисти та гаструляції[8].

Див. також

  • Хромосома 12

Примітки

  1. ↑ Захворювання, генетично пов'язані з Інсуліноподібний фактор росту 1 переглянути/редагувати посилання на ВікіДаних.
  2. ↑ Human PubMed Reference:.
  3. ↑ Mouse PubMed Reference:.
  4. ↑ HUGO Gene Nomenclature Commitee, HGNC:5464 (англ.) . Архів оригіналу за 26 січня 2018. Процитовано 12 січня 2018.
  5. ↑ UniProt, P05019 (англ.) . Архів оригіналу за 13 січня 2018. Процитовано 12 січня 2018.
  6. ↑ Melmed, S; Polonsky, KS; Larsen, PR; Kronenberg, HM (2011). Williams Textbook of Endocrinology (вид. 11th). Saunders. с. 478–479. ISBN 978-1416029113.
  7. ↑ Rotwein P. (2017). Diversification of the insulin-like growth factor 1 gene in mammals. PloS one, 12(12), e0189642. https://doi.org/10.1371/journal.pone.0189642
  8. ↑ Yaseen, M., Wrenzycki, C., Herrmann, D., Carnwath, J., & Niemann, H. (2001). Changes in the relative abundance of mRNA transcripts for insulin-like growth factor (IGF-I and IGF-II) ligands and their receptors (IGF-IR/IGF-IIR) in preimplantation bovine embryos derived from different in vitro systems. Reproduction, 122(4), 601-610. Retrieved Jan 22, 2024, from https://doi.org/10.1530/rep.0.1220601

Література

  • le Bouc Y., Dreyer D., Jaeger F., Binoux M., Sondermeyer P. (1986). Complete characterization of the human IGF-I nucleotide sequence isolated from a newly constructed adult liver cDNA library. FEBS Lett. 196: 108—112. PMID 2935423 DOI:10.1016/0014-5793(86)80223-X
  • Rotwein P. (1986). Two insulin-like growth factor I messenger RNAs are expressed in human liver. Proc. Natl. Acad. Sci. U.S.A. 83: 77—81. PMID 3455760 DOI:10.1073/pnas.83.1.77
  • Tobin G., Yee D., Brunner N., Rotwein P. (1990). A novel human insulin-like growth factor I messenger RNA is expressed in normal and tumor cells. Mol. Endocrinol. 4: 1914—1920. PMID 2082190 DOI:10.1210/mend-4-12-1914
  • Steenbergh P.H., Koonen-Reemst A.M.C.B., Cleutjens C.B.J.M., Sussenbach J.S. (1991). Complete nucleotide sequence of the high molecular weight human IGF-I mRNA. Biochem. Biophys. Res. Commun. 175: 507—514. PMID 2018498 DOI:10.1016/0006-291X(91)91593-2
  • Sandberg-Nordqvist A.-C., Staehlbom P.-A., Lake M., Sara V.R. (1992). Characterization of two cDNAs encoding insulin-like growth factor 1 (IGF-1) in the human fetal brain. Brain Res. Mol. Brain Res. 12: 275—277. PMID 1372070 DOI:10.1016/0169-328X(92)90094-R
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504


Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.
Вестибуло-окулярний рефлекс Це незавершена стаття з фізіології тварин.
Ви можете допомогти проєкту, виправивши або дописавши її.


  • п
  • о
  • р
Ендокринні
залози
Гіпоталамус+
гіпофіз
Задня доля гіпофізу
Передня доля гіпофізу
Гонадна вісь
Інші
  • Інсуліноподібний фактор росту
Ентерохромаффінні клітини
Послідовність амінокислот
1020304050
MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGP
ETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSC
DLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRK
GWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK